Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANGRF Peptide - C-terminal region

RANGRF Peptide - C-terminal region

Product Specifications

Product Name Alternative

MOG1, HSPC165, HSPC236, RANGNRF

UniProt

Q9HD47

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RANGRF Rabbit Polyclonal Antibody (orb588503) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLHQALLRLPQYQTDLLLTFNQPPPDNRSSLGPENLSPAPWSLGDFEQLV

More Discoveries

Explore Other Products

Browse additional items from our catalog

IDH3G Lentiviral Activation Particles (h2)
sc-404994-LAC-2 200 µL

IDH3G Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
R4707 Desktop Printer & Applicator Open Core Ribbons
139777 1 Pack (1 Ribbon (s) x 1 Pack)

R4707 Desktop Printer & Applicator Open Core Ribbons

Sign In for Pricing
View Details
Rabbit Polyclonal APEH Antibody [Alexa Fluor 405]
NBP2-99357AF405 0.1 mL

Rabbit Polyclonal APEH Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
Prss34 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4203603 1.0 µg DNA

Prss34 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Recombinant Human Endoplasmin (HSP90B1), partial
orb1096583-01 20 µg

Recombinant Human Endoplasmin (HSP90B1), partial

Sign In for Pricing
View Details
Recombinant Human Endoplasmin (HSP90B1), partial
orb1096583-02 100 µg

Recombinant Human Endoplasmin (HSP90B1), partial

Sign In for Pricing
View Details