Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPC1L1 Peptide - N-terminal region

NPC1L1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

LDLCQ7, NPC11L1, SLC65A2

UniProt

Q9UHC9

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NPC1L1 Rabbit Polyclonal Antibody (orb327371) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YGSALCNAQRWLNFQGDTGNGLAPLDITFHLLEPGQAVGSGIQPLNEGVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Meis2 Rabbit Polyclonal Antibody
TA363090 100 µL

Meis2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
3,5-Dichlorobenzonitrile
TRC-D436528-500MG 500 mg

3,5-Dichlorobenzonitrile

Sign In for Pricing
View Details
Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2714), 0.2mg/mL
BNUB2714-100 1x 100 µL

Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2714), 0.2mg/mL

Sign In for Pricing
View Details
KIF4B (NM_001099293) Human Over-expression Lysate
LC420429 20 µg

KIF4B (NM_001099293) Human Over-expression Lysate

Sign In for Pricing
View Details
IER5 Rabbit Polyclonal Antibody
TA368531 100 µL

IER5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse St7 activation kit by CRISPRa
GA206445 1 Kit

Mouse St7 activation kit by CRISPRa

Sign In for Pricing
View Details