Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPC1L1 Peptide - N-terminal region

NPC1L1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

LDLCQ7, NPC11L1, SLC65A2

UniProt

Q9UHC9

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NPC1L1 Rabbit Polyclonal Antibody (orb327371) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YGSALCNAQRWLNFQGDTGNGLAPLDITFHLLEPGQAVGSGIQPLNEGVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL17RA Protein (His Tag)
PKSH033629-01 10 µg

Recombinant Human IL17RA Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IL17RA Protein (His Tag)
PKSH033629-02 50 µg

Recombinant Human IL17RA Protein (His Tag)

Sign In for Pricing
View Details
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2289R), CF640R conjugate, 0.1mg/mL
BNC402289-100 1x 100 µL

Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2289R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human SLC22A1 activation kit by CRISPRa
GA104498 1 Kit

Human SLC22A1 activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18/834), 0.2mg/mL
BNUB0834-100 1x 100 µL

Cytokeratin 18 (KRT18/834), 0.2mg/mL

Sign In for Pricing
View Details
rac Zosuquidar-d5 Trihydrochloride
TRC-Z700872-75MG 75 mg

rac Zosuquidar-d5 Trihydrochloride

Sign In for Pricing
View Details