Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMED7 Peptide - C-terminal region

TMED7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TMED7, CGI-109

UniProt

Q9Y3B3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMED7 Rabbit Polyclonal Antibody (orb327372) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_861974

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAYWSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

53BP1 (TP53BP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G3]
TA806938AM 100 µL

53BP1 (TP53BP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G3]

Sign In for Pricing
View Details
TRPV6 AAV Vector (Mouse) (CMV)
48535104 1 µg

TRPV6 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Lentiviral mouse Eps15l1 shRNA (UAS) - Lentiviral mouse Eps15l1 shRNA (UAS, iRFP) (25)
GTR15239798 1 Vial

Lentiviral mouse Eps15l1 shRNA (UAS) - Lentiviral mouse Eps15l1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Rabbit Polyclonal Slain2 Antibody [FITC]
NBP2-41117F 0.1 mL

Rabbit Polyclonal Slain2 Antibody [FITC]

Sign In for Pricing
View Details
Vmn1r28 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3036102 1.0 µg DNA

Vmn1r28 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
HSP60 (LK2), CF405S conjugate, 0.1mg/mL
BNC040852-100 1x 100 µL

HSP60 (LK2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details