Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMED7 Peptide - C-terminal region

TMED7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TMED7, CGI-109

UniProt

Q9Y3B3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMED7 Rabbit Polyclonal Antibody (orb327372) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_861974

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAYWSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethanol-13C2
TRC-E890121-1G 1 g

Ethanol-13C2

Sign In for Pricing
View Details
PIWIL1, ID (Piwi-like Protein 1, HIWI) (APC) discontinued
P4210-35B-APC 200 µL

PIWIL1, ID (Piwi-like Protein 1, HIWI) (APC) discontinued

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (NKI/C3 + LAMP3/968), 0.2mg/mL
BNUB1160-500 1x 500 µL

CD63 (Late Endosomes Marker) (NKI/C3 + LAMP3/968), 0.2mg/mL

Sign In for Pricing
View Details
Lentiviral human TMEM19 shRNA (UAS) - Lentiviral human TMEM19 shRNA (UAS) (100)
GTR15318321 1 Vial

Lentiviral human TMEM19 shRNA (UAS) - Lentiviral human TMEM19 shRNA (UAS) (100)

Sign In for Pricing
View Details
Ring Finger And FYVE Like Domain Containing E3 Ubiquitin Protein Ligase (RFFL) Antibody
abx004976-01 60 µL

Ring Finger And FYVE Like Domain Containing E3 Ubiquitin Protein Ligase (RFFL) Antibody

Sign In for Pricing
View Details
Ring Finger And FYVE Like Domain Containing E3 Ubiquitin Protein Ligase (RFFL) Antibody
abx004976-02 120 µL

Ring Finger And FYVE Like Domain Containing E3 Ubiquitin Protein Ligase (RFFL) Antibody

Sign In for Pricing
View Details