Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBXN1 Peptide - N-terminal region

UBXN1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

UBXN1, SAKS1

UniProt

Q04323

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBXN1 Rabbit Polyclonal Antibody (orb327374) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHILGREPTSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPSF1 Antibody
KC-28980-01 50 μL

CPSF1 Antibody

Sign In for Pricing
View Details
CPSF1 Antibody
KC-28980-02 100 µL

CPSF1 Antibody

Sign In for Pricing
View Details
CPSF1 Antibody
KC-28980-03 1 mL

CPSF1 Antibody

Sign In for Pricing
View Details
Human PSMD3 activation kit by CRISPRa
GA103877 1 Kit

Human PSMD3 activation kit by CRISPRa

Sign In for Pricing
View Details
CT47A4 Human Gene Knockout Kit (CRISPR)
KN418246 1 Kit

CT47A4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dehydroepiandrosterone (Dhea) (16,16-D2, 97%)
TRC-D229593-2.5MG 2.5 mg

Dehydroepiandrosterone (Dhea) (16,16-D2, 97%)

Sign In for Pricing
View Details