Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RSL24D1 Peptide - N-terminal region

RSL24D1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

L30, RLP24, RPL24, TVAS3, RPL24L, C15orf15, HRP-L30-iso

UniProt

Q9UHA3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RSL24D1 Rabbit Polyclonal Antibody (orb327377) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_057388

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRTAP25-1 (NM_001128598) Human Tagged ORF Clone
RC225022 10 µg

KRTAP25-1 (NM_001128598) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal TMED8 Antibody
NBP2-85934-0.1mL 0.1 mL

Rabbit Polyclonal TMED8 Antibody

Sign In for Pricing
View Details
Pig NEFL / Neurofilament light polypeptide Recombinant Protein
R10709p 1 Each

Pig NEFL / Neurofilament light polypeptide Recombinant Protein

Sign In for Pricing
View Details
LECT2 Peptide - N-terminal region
MBS3241233-01 0.1 mg

LECT2 Peptide - N-terminal region

Sign In for Pricing
View Details
LECT2 Peptide - N-terminal region
MBS3241233-02 5x 0.1 mg

LECT2 Peptide - N-terminal region

Sign In for Pricing
View Details
OTUB2 Mouse Monoclonal Antibody [Clone ID: OTI2F6]
TA501944S 30 µL

OTUB2 Mouse Monoclonal Antibody [Clone ID: OTI2F6]

Sign In for Pricing
View Details