Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RSL24D1 Peptide - N-terminal region

RSL24D1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

L30, RLP24, RPL24, TVAS3, RPL24L, C15orf15, HRP-L30-iso

UniProt

Q9UHA3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RSL24D1 Rabbit Polyclonal Antibody (orb327377) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_057388

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(3-Phenylpropyl)carbamic Acid Ethyl Ester
TRC-P336255-1G 1 g

(3-Phenylpropyl)carbamic Acid Ethyl Ester

Sign In for Pricing
View Details
ARIH2 Peptide
MBS3227035-01 0.1 mg

ARIH2 Peptide

Sign In for Pricing
View Details
ARIH2 Peptide
MBS3227035-02 5x 0.1 mg

ARIH2 Peptide

Sign In for Pricing
View Details
Mouse Xkr6 activation kit by CRISPRa
GA213598 1 Kit

Mouse Xkr6 activation kit by CRISPRa

Sign In for Pricing
View Details
CLCC1 Antibody - N-terminal region
ARP44969_P050-25UL 25 µL

CLCC1 Antibody - N-terminal region

Sign In for Pricing
View Details
Mouse Monoclonal Cytokeratin 15 Antibody (LHK15) [FITC]
NBP2-54462F 100 µL

Mouse Monoclonal Cytokeratin 15 Antibody (LHK15) [FITC]

Sign In for Pricing
View Details