Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NELFCD Peptide - N-terminal region

NELFCD Peptide - N-terminal region

Product Specifications

Product Name Alternative

TH1, TH1L, NELF-C, NELF-D, HSPC130

UniProt

Q8IXH7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NELFCD Rabbit Polyclonal Antibody (orb327378) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MAGAVPGAIMDEDYYGSAAEWGDEADGGQQEDDSGEGEDDAEVQQECLHK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine recombinant IL-21 protein
PROTQ6L7I9-500ug 500 µg

Canine recombinant IL-21 protein

Sign In for Pricing
View Details
ADPRS Protein (N-His, Human)
P500326 100 µg

ADPRS Protein (N-His, Human)

Sign In for Pricing
View Details
Bovine Cross Linked C-telopeptide Of Type I Collagen (CTX-I) ELISA Kit
JL22461-01 48 Tests

Bovine Cross Linked C-telopeptide Of Type I Collagen (CTX-I) ELISA Kit

Sign In for Pricing
View Details
Bovine Cross Linked C-telopeptide Of Type I Collagen (CTX-I) ELISA Kit
JL22461-02 96 Tests

Bovine Cross Linked C-telopeptide Of Type I Collagen (CTX-I) ELISA Kit

Sign In for Pricing
View Details
Chicken 2-Glycerol Arachidonic Acid ELISA Kit
MBS7264777-01 48 Well

Chicken 2-Glycerol Arachidonic Acid ELISA Kit

Sign In for Pricing
View Details
Chicken 2-Glycerol Arachidonic Acid ELISA Kit
MBS7264777-02 96 Well

Chicken 2-Glycerol Arachidonic Acid ELISA Kit

Sign In for Pricing
View Details