Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NELFCD Peptide - N-terminal region

NELFCD Peptide - N-terminal region

Product Specifications

Product Name Alternative

TH1, TH1L, NELF-C, NELF-D, HSPC130

UniProt

Q8IXH7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NELFCD Rabbit Polyclonal Antibody (orb327378) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MAGAVPGAIMDEDYYGSAAEWGDEADGGQQEDDSGEGEDDAEVQQECLHK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM33 (Transmembrane Protein 33, Protein DB83, DB83) discontinued
T6020-21A 50 µg

TMEM33 (Transmembrane Protein 33, Protein DB83, DB83) discontinued

Sign In for Pricing
View Details
THR-β agonist 8
T203424-01 10 mg

THR-β agonist 8

Sign In for Pricing
View Details
THR-β agonist 8
T203424-02 50 mg

THR-β agonist 8

Sign In for Pricing
View Details
Ipilimumab (anti-CTLA-4)
A2001-1mg*25 25x 1 mg

Ipilimumab (anti-CTLA-4)

Sign In for Pricing
View Details
M6PR (cation independent) Rabbit mAb
C05580-01 20 µL

M6PR (cation independent) Rabbit mAb

Sign In for Pricing
View Details
M6PR (cation independent) Rabbit mAb
C05580-02 100 µL

M6PR (cation independent) Rabbit mAb

Sign In for Pricing
View Details