MED15 Peptide - C-terminal region
MED15 Peptide - C-terminal region
Product Specifications
Product Name Alternative
MED15, ARC105, CTG7A, PCQAP, TIG1, TNRC7
UniProt
Q96RN5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MED15 Rabbit Polyclonal Antibody (orb588507) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TPQSMPPPPQPSPQPGQPSSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
CST 48160T 20 µL
DNA Polymerase θ (POLQ) (153-5-1) Mouse Monoclonal Antibody
Sign In for Pricing
View Details 
MBS623138-01 0.025 mL
WBSCR14 (Williams Beuren Syndrome Chromosome Region 14, Williams-Beuren Syndrome Chromosome Region 14 Protein, Carbohydrate Responsive Element Binding Protein, CHREBP, MIO, MLX Interacting Protein-like, MLXIPL, Mlx Interactor, MONDOB, WS Basic Helix-loop-
Sign In for Pricing
View Details MBS623138-02 0.1 mL
WBSCR14 (Williams Beuren Syndrome Chromosome Region 14, Williams-Beuren Syndrome Chromosome Region 14 Protein, Carbohydrate Responsive Element Binding Protein, CHREBP, MIO, MLX Interacting Protein-like, MLXIPL, Mlx Interactor, MONDOB, WS Basic Helix-loop-
Sign In for Pricing
View Details MBS623138-03 5x 0.1 mL
WBSCR14 (Williams Beuren Syndrome Chromosome Region 14, Williams-Beuren Syndrome Chromosome Region 14 Protein, Carbohydrate Responsive Element Binding Protein, CHREBP, MIO, MLX Interacting Protein-like, MLXIPL, Mlx Interactor, MONDOB, WS Basic Helix-loop-
Sign In for Pricing
View Details