Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED15 Peptide - C-terminal region

MED15 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MED15, ARC105, CTG7A, PCQAP, TIG1, TNRC7

UniProt

Q96RN5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MED15 Rabbit Polyclonal Antibody (orb588507) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TPQSMPPPPQPSPQPGQPSSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFN gamma Protein, Marmota monax, Recombinant (His)
TMPH-02451-01 5 µg

IFN gamma Protein, Marmota monax, Recombinant (His)

Sign In for Pricing
View Details
IFN gamma Protein, Marmota monax, Recombinant (His)
TMPH-02451-02 10 µg

IFN gamma Protein, Marmota monax, Recombinant (His)

Sign In for Pricing
View Details
IFN gamma Protein, Marmota monax, Recombinant (His)
TMPH-02451-03 20 µg

IFN gamma Protein, Marmota monax, Recombinant (His)

Sign In for Pricing
View Details
IFN gamma Protein, Marmota monax, Recombinant (His)
TMPH-02451-04 50 µg

IFN gamma Protein, Marmota monax, Recombinant (His)

Sign In for Pricing
View Details
IFN gamma Protein, Marmota monax, Recombinant (His)
TMPH-02451-05 100 µg

IFN gamma Protein, Marmota monax, Recombinant (His)

Sign In for Pricing
View Details
IFN gamma Protein, Marmota monax, Recombinant (His)
TMPH-02451-06 200 µg

IFN gamma Protein, Marmota monax, Recombinant (His)

Sign In for Pricing
View Details