Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAF9B Peptide - C-terminal region

TAF9B Peptide - C-terminal region

Product Specifications

Product Name Alternative

TAF9B, TAF9L

UniProt

Q9HBM6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TAF9B Rabbit Polyclonal Antibody (orb588508) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_057059

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TAVQNVLINPSMIGPKNILITTNMVSSQNTANEANPLKRKHEDDDDNDIM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT18P15 AAV siRNA Pooled Vector
25952161 1.0 µg

KRT18P15 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Anti-human IL-6 / IFNb2 (MEDI 5117 Biosimilar)
BIO0672SM-1mg 1 mg

Anti-human IL-6 / IFNb2 (MEDI 5117 Biosimilar)

Sign In for Pricing
View Details
Culture Medium for Human Pancreatic Cancer Cells [PANC 08.13]
AFG-ELL-3607-01 125 mL

Culture Medium for Human Pancreatic Cancer Cells [PANC 08.13]

Sign In for Pricing
View Details
Culture Medium for Human Pancreatic Cancer Cells [PANC 08.13]
AFG-ELL-3607-02 500 mL

Culture Medium for Human Pancreatic Cancer Cells [PANC 08.13]

Sign In for Pricing
View Details
Selpercatinib (LOXO-292) 200mg
A18637-200 200 mg

Selpercatinib (LOXO-292) 200mg

Sign In for Pricing
View Details
MAP4K5 Rabbit Polyclonal Antibody (Fluoro647)
orb3096617 100 µg

MAP4K5 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details