Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UIMC1 Peptide - middle region

UIMC1 Peptide - middle region

Product Specifications

Product Name Alternative

UIMC1, RAP80, RXRIP110

UniProt

Q96RL1

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UIMC1 Rabbit Polyclonal Antibody (orb331495) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GEQASEKNECISEDMGDEDKEERQESRASDWHSKTKDFQESSIKSLKEKL

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR2F2 Antibody
MBS8591566-01 0.1 mg

NR2F2 Antibody

Sign In for Pricing
View Details
NR2F2 Antibody
MBS8591566-02 0.1 mL (AF405L)

NR2F2 Antibody

Sign In for Pricing
View Details
NR2F2 Antibody
MBS8591566-03 0.1 mL (AF405S)

NR2F2 Antibody

Sign In for Pricing
View Details
NR2F2 Antibody
MBS8591566-04 0.1 mL (AF610)

NR2F2 Antibody

Sign In for Pricing
View Details
NR2F2 Antibody
MBS8591566-05 0.1 mL (AF635)

NR2F2 Antibody

Sign In for Pricing
View Details
NR2F2 Antibody
MBS8591566-06 0.1 mL (APC)

NR2F2 Antibody

Sign In for Pricing
View Details