UIMC1 Peptide - middle region
UIMC1 Peptide - middle region
Product Specifications
Product Name Alternative
UIMC1, RAP80, RXRIP110
UniProt
Q96RL1
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with UIMC1 Rabbit Polyclonal Antibody (orb331495) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GEQASEKNECISEDMGDEDKEERQESRASDWHSKTKDFQESSIKSLKEKL
More Discoveries
Explore Other Products
Browse additional items from our catalog
15432124 3x 1.0µg DNA
CCR8 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
Sign In for Pricing
View Details MBS9912567-01 48 Well
Mouse Transforming Acidic Coiled-Coil-Containing Protein 2 (TACC2) ELISA Kit
Sign In for Pricing
View Details 
MBS9912567-02 96 Well
Mouse Transforming Acidic Coiled-Coil-Containing Protein 2 (TACC2) ELISA Kit
Sign In for Pricing
View Details MBS9912567-03 5x 96 Well
Mouse Transforming Acidic Coiled-Coil-Containing Protein 2 (TACC2) ELISA Kit
Sign In for Pricing
View Details MBS9912567-04 10x 96 Well
Mouse Transforming Acidic Coiled-Coil-Containing Protein 2 (TACC2) ELISA Kit
Sign In for Pricing
View Details 