Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UIMC1 Peptide - middle region

UIMC1 Peptide - middle region

Product Specifications

Product Name Alternative

UIMC1, RAP80, RXRIP110

UniProt

Q96RL1

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UIMC1 Rabbit Polyclonal Antibody (orb331496) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GIPFCPDGVDPNQYTKVILCQLEVYQKSLKMAQRQLLNKKGFGEPVLPRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab29 Rabbit pAb
APA2127-01 30 µL

Rab29 Rabbit pAb

Sign In for Pricing
View Details
Rab29 Rabbit pAb
APA2127-02 50 μL

Rab29 Rabbit pAb

Sign In for Pricing
View Details
Rab29 Rabbit pAb
APA2127-03 100 µL

Rab29 Rabbit pAb

Sign In for Pricing
View Details
Lentiviral mouse Rasef shRNA (UAS) - Lentiviral mouse Rasef shRNA (UAS, iRFP) plasmid
GTR15203056 1 Vial

Lentiviral mouse Rasef shRNA (UAS) - Lentiviral mouse Rasef shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Recombinant Human IL-6 GMP
P7441-100μg 100 µg

Recombinant Human IL-6 GMP

Sign In for Pricing
View Details
JUNB Rabbit Polyclonal Antibody
orb576539 100 µL

JUNB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details