Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UIMC1 Peptide - middle region

UIMC1 Peptide - middle region

Product Specifications

Product Name Alternative

UIMC1, RAP80, RXRIP110

UniProt

Q96RL1

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UIMC1 Rabbit Polyclonal Antibody (orb331496) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GIPFCPDGVDPNQYTKVILCQLEVYQKSLKMAQRQLLNKKGFGEPVLPRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRTM4 Antibody, Biotin conjugated
MBS7050638-01 0.05 mg

LRRTM4 Antibody, Biotin conjugated

Sign In for Pricing
View Details
LRRTM4 Antibody, Biotin conjugated
MBS7050638-02 0.1 mg

LRRTM4 Antibody, Biotin conjugated

Sign In for Pricing
View Details
LRRTM4 Antibody, Biotin conjugated
MBS7050638-03 5x 0.1 mg

LRRTM4 Antibody, Biotin conjugated

Sign In for Pricing
View Details
CASP8 3'UTR Luciferase Stable Cell Line
TU003509 1.0 mL

CASP8 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
DOCK10 Protein Vector (Human) (pPM-C-HA)
PV012915 500 ng

DOCK10 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral mouse H2bc21 shRNA (UAS) - Lentiviral mouseH2bc21 shRNA (UAS, GFP) (25)
GTR15216752 1 Vial

Lentiviral mouse H2bc21 shRNA (UAS) - Lentiviral mouseH2bc21 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details