NGLY1 Peptide - middle region
NGLY1 Peptide - middle region
Product Specifications
Product Name Alternative
NGLY1, PNG1
UniProt
Q96IV0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NGLY1 Rabbit Polyclonal Antibody (orb588517) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DRSLLPSDDELKWGAKEVEDHYCDACQFSNRFPRYNNPEKLLETRCGRCG
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-5396R-APC-Cy7 100 µL
Phospho-IRS1 (Ser312) Polyclonal Antibody, APC-Cy7 Conjugated
Sign In for Pricing
View Details 
sc-429120-LAC 200 µL
1700026D08Rik Lentiviral Activation Particles (m)
Sign In for Pricing
View Details 
