NGLY1 Peptide - middle region
NGLY1 Peptide - middle region
Product Specifications
Product Name Alternative
NGLY1, PNG1
UniProt
Q96IV0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NGLY1 Rabbit Polyclonal Antibody (orb588517) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DRSLLPSDDELKWGAKEVEDHYCDACQFSNRFPRYNNPEKLLETRCGRCG
More Discoveries
Explore Other Products
Browse additional items from our catalog
124278 100 µg
CAMK1 (Calcium/Calmodulin-dependent Protein Kinase Type 1, CaM Kinase I, CaM-KI, CaM Kinase I alpha, CaMKI-alpha, MGC120317, MGC120318)
Sign In for Pricing
View Details K4169906 1.0 µg DNA
Aim1l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
Sign In for Pricing
View Details 
RC230316L4 10 µg
SSX2IP (NM_001166294) Human Tagged Lenti ORF Clone
Sign In for Pricing
View Details LH04088V 100 µg
ApoER2 (LRP8) (NM_001018054) Human Over-expression Lysate
Sign In for Pricing
View Details