Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASKIN2 Peptide - C-terminal region

CASKIN2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ANKS5B

UniProt

Q8WXE0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CASKIN2 Rabbit Polyclonal Antibody (orb327382) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_065804

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PQGSPSSPAPGPPPGAPWAFSYLAGPPATPPDPPRPKRRSHSLSRPGPTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Slit2 Antibody (05) [DyLight 405]
NBP3-26897V 0.1 mL

Mouse Monoclonal Slit2 Antibody (05) [DyLight 405]

Sign In for Pricing
View Details
Intersectin 1 (ITSN1) Polyclonal Antibody
CAU24141-01 100 µL

Intersectin 1 (ITSN1) Polyclonal Antibody

Sign In for Pricing
View Details
Intersectin 1 (ITSN1) Polyclonal Antibody
CAU24141-02 200 µL

Intersectin 1 (ITSN1) Polyclonal Antibody

Sign In for Pricing
View Details
Intersectin 1 (ITSN1) Polyclonal Antibody
CAU24141-03 1 mL

Intersectin 1 (ITSN1) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal MEIS1 Antibody (SR3560)
NBP3-27780-50ul 50 µL

Rabbit Monoclonal MEIS1 Antibody (SR3560)

Sign In for Pricing
View Details
Recombinant Mycobacterium Ulcerans ilvC Protein (aa 1-333)
VAng-Yyj4078-500gEcoli 500 µg (E. coli)

Recombinant Mycobacterium Ulcerans ilvC Protein (aa 1-333)

Sign In for Pricing
View Details