Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAP1 Peptide - N-terminal region

TRAP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TRAP1, HSP75

UniProt

Q12931

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057376

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KPILCPRRTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 546-streptavidin conjugate
16958-AAT 200 µg

IFluor® 546-streptavidin conjugate

Sign In for Pricing
View Details
Lysozyme Rabbit Polyclonal Antibody
ER1803-88 100 µL

Lysozyme Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Presenilin-1 (phospho S310) Antibody
RC-6954-01 50 μL

Recombinant Presenilin-1 (phospho S310) Antibody

Sign In for Pricing
View Details
Recombinant Presenilin-1 (phospho S310) Antibody
RC-6954-02 100 µL

Recombinant Presenilin-1 (phospho S310) Antibody

Sign In for Pricing
View Details
Recombinant Presenilin-1 (phospho S310) Antibody
RC-6954-03 1 mL

Recombinant Presenilin-1 (phospho S310) Antibody

Sign In for Pricing
View Details
Midkine (MDK) (NM_002391) Human Over-expression Lysate
LY419358 100 µg

Midkine (MDK) (NM_002391) Human Over-expression Lysate

Sign In for Pricing
View Details