Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAP1 Peptide - N-terminal region

TRAP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TRAP1, HSP75

UniProt

Q12931

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057376

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KPILCPRRTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fodrin / Alpha Spectrin II (SPTAN1) / NEAS (SPTAN1/3351), CF740 conjugate, 0.1mg/mL
BNC743351-100 1x 100 µL

Fodrin / Alpha Spectrin II (SPTAN1) / NEAS (SPTAN1/3351), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4930595M18Rik Mouse Gene Knockout Kit (CRISPR)
KN500410 1 Kit

4930595M18Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Propyl 3,5-Dichloro-4-hydroxybenzoate
TRC-P839408-10MG 10 mg

Propyl 3,5-Dichloro-4-hydroxybenzoate

Sign In for Pricing
View Details
RO60 Rabbit Polyclonal Antibody
TA369371 100 µL

RO60 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), 0.2mg/mL
BNUB1073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), 0.2mg/mL

Sign In for Pricing
View Details
CYP27B1 (NM_000785) Human Over-expression Lysate
LY400269 100 µg

CYP27B1 (NM_000785) Human Over-expression Lysate

Sign In for Pricing
View Details