Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REST Peptide - N-terminal region

REST Peptide - N-terminal region

Product Specifications

Product Name Alternative

REST, NRSF, XBR

UniProt

Q13127

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with REST Rabbit Polyclonal Antibody (orb574041) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005603

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGSSTAEEGDFSKGPIRCDRCGYNTNRYDHYTAHLKHHTRAGDNERVYKC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Glucagon/GCG Protein (His Tag)
PKSH032491-01 10 µg

Recombinant Human Glucagon/GCG Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Glucagon/GCG Protein (His Tag)
PKSH032491-02 50 µg

Recombinant Human Glucagon/GCG Protein (His Tag)

Sign In for Pricing
View Details
Human DHX8 activation kit by CRISPRa
GA101171 1 Kit

Human DHX8 activation kit by CRISPRa

Sign In for Pricing
View Details
NDUFA8 Human Gene Knockout Kit (CRISPR)
KN400061 1 Kit

NDUFA8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(3-Benzyloxypropyl)triphenylphosphonium Bromide
TRC-B287980-1G 1 g

(3-Benzyloxypropyl)triphenylphosphonium Bromide

Sign In for Pricing
View Details
Carbobenzoxy-D,L-tryptophanamide
TRC-C176000-250MG 250 mg

Carbobenzoxy-D,L-tryptophanamide

Sign In for Pricing
View Details