Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REST Peptide - N-terminal region

REST Peptide - N-terminal region

Product Specifications

Product Name Alternative

REST, NRSF, XBR

UniProt

Q13127

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with REST Rabbit Polyclonal Antibody (orb574041) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005603

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGSSTAEEGDFSKGPIRCDRCGYNTNRYDHYTAHLKHHTRAGDNERVYKC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Climatic Chamber BCCL-1408
BCCL-1408 1 Unit

Climatic Chamber BCCL-1408

Sign In for Pricing
View Details
(+)-Viridiflorol
TRC-V673900-10MG 10 mg

(+)-Viridiflorol

Sign In for Pricing
View Details
Von Willebrand Factor (VWF) (NM_000552) Human Over-expression Lysate
LC424643 20 µg

Von Willebrand Factor (VWF) (NM_000552) Human Over-expression Lysate

Sign In for Pricing
View Details
Bradykinin Trifluoroacetic Acid
TRC-B676780-1MG 1 mg

Bradykinin Trifluoroacetic Acid

Sign In for Pricing
View Details
SLFNL1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G2]
TA501908AM 100 µL

SLFNL1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G2]

Sign In for Pricing
View Details
Bromocyclopentane-d9
TRC-B682827-250MG 250 mg

Bromocyclopentane-d9

Sign In for Pricing
View Details