ZNF618 Peptide - middle region
ZNF618 Peptide - middle region
Product Specifications
Product Name Alternative
NEDD10, FP13169
UniProt
Q5T7W0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF618 Rabbit Polyclonal Antibody (orb324408) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TLLHRTPPATQTQTFRTPNSGSPASKATAAESAFSRRVEGKAQNHFEETN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
17016-AAT 25 nmoles
Biotin-11-dUTP *1 mM in TE Buffer (pH 7.5) * *CAS 86303-25-5*
Sign In for Pricing
View Details 
BNC880827-100 1x 100 µL
Involucrin (IVRN/827), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TP310359M 100 µg
Serine racemase (SRR) (NM_021947) Human Recombinant Protein
Sign In for Pricing
View Details