ZNF618 Peptide - middle region
ZNF618 Peptide - middle region
Product Specifications
Product Name Alternative
NEDD10, FP13169
UniProt
Q5T7W0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF618 Rabbit Polyclonal Antibody (orb324408) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TLLHRTPPATQTQTFRTPNSGSPASKATAAESAFSRRVEGKAQNHFEETN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
