Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLI1 Peptide - C-terminal region

GLI1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GLI1, GLI

UniProt

P08151

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GLI1 Rabbit Polyclonal Antibody (orb574163) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VGGTNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pure Canavalia ensiformis Lectin (Jackbean) -Con A-
L-1104-500 500 mg

Pure Canavalia ensiformis Lectin (Jackbean) -Con A-

Sign In for Pricing
View Details
Vandetanib N-Oxide
TRC-V097110-5MG 5 mg

Vandetanib N-Oxide

Sign In for Pricing
View Details
CLCA1 Goat Polyclonal Antibody
AP31555PU-N 100 µg

CLCA1 Goat Polyclonal Antibody

Sign In for Pricing
View Details
CF®568 Biocytin
#92005 1x 0.5 mg

CF®568 Biocytin

Sign In for Pricing
View Details
Tissue Total RNA, Pancreas
CR561533 5 µg

Tissue Total RNA, Pancreas

Sign In for Pricing
View Details
Spexyte™ Intracellular pH Calibration Buffer Kit
21235-AAT 100 Tests

Spexyte™ Intracellular pH Calibration Buffer Kit

Sign In for Pricing
View Details