GLI1 Peptide - C-terminal region
GLI1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
GLI1, GLI
UniProt
P08151
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GLI1 Rabbit Polyclonal Antibody (orb574163) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VGGTNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAIL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC427001 20 µg
ABIN3 (TNIP3) (NM_001128843) Human Over-expression Lysate
Sign In for Pricing
View Details ![BID Rabbit Monoclonal Antibody [Clone ID: R08-2F0]](https://cdn.genprice.uk/products/937/68dd1b60061270361ea12414/imageurl/ta421850.webp)
AP20201PU-N 100 µg
Synaptotagmin 1 (SYT1) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
