Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMD6 Peptide - N-terminal region

PSMD6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PSMD6, KIAA0107, PFAAP4

UniProt

Q15008

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSMD6 Rabbit Polyclonal Antibody (orb574474) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_055629

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDIVFY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA kit for Mouse Prostaglandin-H2 D-isomerase (PTGDS)
KTE70625-01 48 Tests

ELISA kit for Mouse Prostaglandin-H2 D-isomerase (PTGDS)

Sign In for Pricing
View Details
ELISA kit for Mouse Prostaglandin-H2 D-isomerase (PTGDS)
KTE70625-02 96 Tests

ELISA kit for Mouse Prostaglandin-H2 D-isomerase (PTGDS)

Sign In for Pricing
View Details
ELISA kit for Mouse Prostaglandin-H2 D-isomerase (PTGDS)
KTE70625-03 5x 96 Well

ELISA kit for Mouse Prostaglandin-H2 D-isomerase (PTGDS)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Phenol-soluble modulin alpha 3 peptide (psmA3)
MBS1103614-01 0.05 mg (E-Coli)

Recombinant Staphylococcus aureus Phenol-soluble modulin alpha 3 peptide (psmA3)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Phenol-soluble modulin alpha 3 peptide (psmA3)
MBS1103614-02 0.2 mg (E-Coli)

Recombinant Staphylococcus aureus Phenol-soluble modulin alpha 3 peptide (psmA3)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Phenol-soluble modulin alpha 3 peptide (psmA3)
MBS1103614-03 0.5 mg (E-Coli)

Recombinant Staphylococcus aureus Phenol-soluble modulin alpha 3 peptide (psmA3)

Sign In for Pricing
View Details