Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMD6 Peptide - N-terminal region

PSMD6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PSMD6, KIAA0107, PFAAP4

UniProt

Q15008

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSMD6 Rabbit Polyclonal Antibody (orb574474) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_055629

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDIVFY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Optc sgRNA CRISPR Lentivector (Rat) (Target 2)
K6450503 1.0 µg DNA

Optc sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
PEX11B Blocking Peptide
MBS9624454-01 1 mg

PEX11B Blocking Peptide

Sign In for Pricing
View Details
PEX11B Blocking Peptide
MBS9624454-02 5x 1 mg

PEX11B Blocking Peptide

Sign In for Pricing
View Details
ACAA1 Blocking Peptide (Center)
MBS9228708-01 0.5 mg

ACAA1 Blocking Peptide (Center)

Sign In for Pricing
View Details
ACAA1 Blocking Peptide (Center)
MBS9228708-02 5x 0.5 mg

ACAA1 Blocking Peptide (Center)

Sign In for Pricing
View Details
Rat Beta-hexosaminidase subunit alpha, HEXA ELISA Kit
MBS1604669-01 48 Well

Rat Beta-hexosaminidase subunit alpha, HEXA ELISA Kit

Sign In for Pricing
View Details