Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARFIP2 Peptide - C-terminal region

ARFIP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

POR1

UniProt

P53365

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARFIP2 Rabbit Polyclonal Antibody (orb324455) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_005252897

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEYDAYRTDLEELSLGPRDAGTRGRLESAQATFQAHRDKYEKLRGDVAIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Nrxn1 shRNA (UAS) - Lentiviral mouse Nrxn1 shRNA (UAS, iRFP) (100)
GTR15297486 1 Vial

Lentiviral mouse Nrxn1 shRNA (UAS) - Lentiviral mouse Nrxn1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Nuclear Factor Kappa B2 (NFKB2) Antibody
abx332100 100 µL

Nuclear Factor Kappa B2 (NFKB2) Antibody

Sign In for Pricing
View Details
SPRR2D discontinued
514532 100 µg

SPRR2D discontinued

Sign In for Pricing
View Details
Islet 1 Rabbit mAb
orb1922070-01 50 µL

Islet 1 Rabbit mAb

Sign In for Pricing
View Details
Islet 1 Rabbit mAb
orb1922070-02 100 µL

Islet 1 Rabbit mAb

Sign In for Pricing
View Details
RHOF sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1821406 1.0 µg DNA

RHOF sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details