Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARFIP2 Peptide - C-terminal region

ARFIP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

POR1

UniProt

P53365

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARFIP2 Rabbit Polyclonal Antibody (orb324455) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_005252897

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEYDAYRTDLEELSLGPRDAGTRGRLESAQATFQAHRDKYEKLRGDVAIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Interleukin 12 Receptor Beta 2 (IL12Rb2)
TRV-0012999-01 10 µg

Recombinant Interleukin 12 Receptor Beta 2 (IL12Rb2)

Sign In for Pricing
View Details
Recombinant Interleukin 12 Receptor Beta 2 (IL12Rb2)
TRV-0012999-02 50 µg

Recombinant Interleukin 12 Receptor Beta 2 (IL12Rb2)

Sign In for Pricing
View Details
Recombinant Interleukin 12 Receptor Beta 2 (IL12Rb2)
TRV-0012999-03 100 µg

Recombinant Interleukin 12 Receptor Beta 2 (IL12Rb2)

Sign In for Pricing
View Details
Recombinant Interleukin 12 Receptor Beta 2 (IL12Rb2)
TRV-0012999-04 200 µg

Recombinant Interleukin 12 Receptor Beta 2 (IL12Rb2)

Sign In for Pricing
View Details
Recombinant Interleukin 12 Receptor Beta 2 (IL12Rb2)
TRV-0012999-05 500 µg

Recombinant Interleukin 12 Receptor Beta 2 (IL12Rb2)

Sign In for Pricing
View Details
Recombinant Interleukin 12 Receptor Beta 2 (IL12Rb2)
TRV-0012999-06 1 mg

Recombinant Interleukin 12 Receptor Beta 2 (IL12Rb2)

Sign In for Pricing
View Details