Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR1H4 Peptide - middle region

NR1H4 Peptide - middle region

Product Specifications

Product Name Alternative

NR1H4, BAR, FXR, HRR1, RIP14

UniProt

Q96RI1

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NR1H4 Rabbit Polyclonal Antibody (orb574778) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CRLRKCKEMGMLAECMYTGLLTEIQCKSKRLRKNVKQHADQTVNEDSEGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-3060-3p agomir
HY-R02905A-01 5 nmol

Mmu-miR-3060-3p agomir

Sign In for Pricing
View Details
Mmu-miR-3060-3p agomir
HY-R02905A-02 20 nmol

Mmu-miR-3060-3p agomir

Sign In for Pricing
View Details
Human GBP2 Protein Lysate 20ug
IHUGBP2PLLY20UG 20 µg

Human GBP2 Protein Lysate 20ug

Sign In for Pricing
View Details
Anti-TTF2 Antibody Picoband® FITC Conjugated
A04344-2-FITC 100 µg/Vial

Anti-TTF2 Antibody Picoband® FITC Conjugated

Sign In for Pricing
View Details
Siglec 7, NT (Sialic Acid-binding Ig-like Lectin 7, Siglec 7, QA79 Membrane Protein, Adhesion Inhibitory Receptor Molecule-1, AIRM-1, p75, D-siglec, AIRM1, D-siglec, CDw328, CD328) (MaxLight 550) discontinued
S1013-60A-ML550 100 µL

Siglec 7, NT (Sialic Acid-binding Ig-like Lectin 7, Siglec 7, QA79 Membrane Protein, Adhesion Inhibitory Receptor Molecule-1, AIRM-1, p75, D-siglec, AIRM1, D-siglec, CDw328, CD328) (MaxLight 550) discontinued

Sign In for Pricing
View Details
TRIM72 shRNA (h) Lentiviral Particles
sc-93129-V 200 µL

TRIM72 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details