Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR1H4 Peptide - middle region

NR1H4 Peptide - middle region

Product Specifications

Product Name Alternative

NR1H4, BAR, FXR, HRR1, RIP14

UniProt

Q96RI1

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NR1H4 Rabbit Polyclonal Antibody (orb574778) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CRLRKCKEMGMLAECMYTGLLTEIQCKSKRLRKNVKQHADQTVNEDSEGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epstein Barr Virus, Nuclear Antigen (EBV) (MaxLight 650) discontinued
E3440-11A-ML650 100 µL

Epstein Barr Virus, Nuclear Antigen (EBV) (MaxLight 650) discontinued

Sign In for Pricing
View Details
CLPS (Colipase, Pancreatic) (Biotin)
MBS6173229-01 0.1 mL

CLPS (Colipase, Pancreatic) (Biotin)

Sign In for Pricing
View Details
CLPS (Colipase, Pancreatic) (Biotin)
MBS6173229-02 5x 0.1 mL

CLPS (Colipase, Pancreatic) (Biotin)

Sign In for Pricing
View Details
Nav1.1 activator 1
MBS5767171 Inquire

Nav1.1 activator 1

Sign In for Pricing
View Details
Rabbit Polyclonal ADE2 Antibody
NBP3-29140 100 µg

Rabbit Polyclonal ADE2 Antibody

Sign In for Pricing
View Details
MYLK-set siRNA/shRNA/RNAi Lentivector (Human)
31262091 4x 500 ng

MYLK-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details