Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCS1 Peptide - N-terminal region

NCS1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NCS1, FLUP, FREQ

UniProt

P62166

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NCS1 Rabbit Polyclonal Antibody (orb575032) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_055101

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRIEFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TPM2 sgRNA gene knockout kit - Lentiviral human TPM2 sgRNA gene knockout kit (100)
GTR15363976 1 Vial

Lentiviral human TPM2 sgRNA gene knockout kit - Lentiviral human TPM2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Anti-eIF3L/Eif3S6Ip Antibody
A02238 100 µL

Anti-eIF3L/Eif3S6Ip Antibody

Sign In for Pricing
View Details
Momelotinib (Cyt387) sulfate salt 5mg
A15056-5 5 mg

Momelotinib (Cyt387) sulfate salt 5mg

Sign In for Pricing
View Details
Nikethamide 10mM * 1mL in DMSO
A17464-10mM-D 10 mM x 1mL in DMSO

Nikethamide 10mM * 1mL in DMSO

Sign In for Pricing
View Details
Recombinant Human Her2 / ERBB2 Protein (His Tag)
ARP7417-01 10 µg

Recombinant Human Her2 / ERBB2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Her2 / ERBB2 Protein (His Tag)
ARP7417-02 50 µg

Recombinant Human Her2 / ERBB2 Protein (His Tag)

Sign In for Pricing
View Details