Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCS1 Peptide - N-terminal region

NCS1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NCS1, FLUP, FREQ

UniProt

P62166

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NCS1 Rabbit Polyclonal Antibody (orb575032) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_055101

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRIEFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C10orf107 sgRNA CRISPR Lentivector (Human) (Target 2)
K0279803 1.0 µg DNA

C10orf107 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Lentiviral mouse Rfx6 shRNA (UAS) - Lentiviral mouse Rfx6 shRNA (UAS, RFP) plasmid
GTR15206149 1 Vial

Lentiviral mouse Rfx6 shRNA (UAS) - Lentiviral mouse Rfx6 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
SLC9C1 Human shRNA Plasmid Kit (Locus ID 285335)
TL301532 1 Kit

SLC9C1 Human shRNA Plasmid Kit (Locus ID 285335)

Sign In for Pricing
View Details
NFH (NEFH) (NM_021076) Human Over-expression Lysate
LS004744-100ug 100 µg

NFH (NEFH) (NM_021076) Human Over-expression Lysate

Sign In for Pricing
View Details
CD7 Recombinant Antibody, PerCP Conjugated
bsm-60231R-PerCP-TR 20 µL

CD7 Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
GMDS Knockout NCI-H1975 Polyclonal Cells
ARG17064 1 Million

GMDS Knockout NCI-H1975 Polyclonal Cells

Sign In for Pricing
View Details