Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP36 Peptide - N-terminal region

ZFP36 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TTP, G0S24, GOS24, TIS11, NUP475, RNF162A

UniProt

P26651

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZFP36 Rabbit Polyclonal Antibody (orb575061) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003398

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFAH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Sushi repeat-containing protein SRPX2, SRPX2 ELISA KIT
ELI-18130b 96 Tests

Bovine Sushi repeat-containing protein SRPX2, SRPX2 ELISA KIT

Sign In for Pricing
View Details
PEPT1 Polyclonal Antibody
orb310872-01 50 μL

PEPT1 Polyclonal Antibody

Sign In for Pricing
View Details
PEPT1 Polyclonal Antibody
orb310872-02 100 µL

PEPT1 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Clostridium Kluyveri infA Protein (aa 1-72)
VAng-Lsx9599-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Kluyveri infA Protein (aa 1-72)

Sign In for Pricing
View Details
LRRC37A12P AAV Vector (Human) (CMV)
27649101 1 µg

LRRC37A12P AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Human Calpain-3 ELISA Kit
MBS2883749-01 48 Well

Human Calpain-3 ELISA Kit

Sign In for Pricing
View Details