Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP36 Peptide - N-terminal region

ZFP36 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TTP, G0S24, GOS24, TIS11, NUP475, RNF162A

UniProt

P26651

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZFP36 Rabbit Polyclonal Antibody (orb575061) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003398

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFAH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INPP5F (OCRL) CytoSection
TS420672P5 25 Slides

INPP5F (OCRL) CytoSection

Sign In for Pricing
View Details
Strumpellin (WASHC5) Human Gene Knockout Kit (CRISPR)
KN410620 1 Kit

Strumpellin (WASHC5) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mifamurtide
sc-481153 100 µg

Mifamurtide

Sign In for Pricing
View Details
Rabbit Polyclonal DDX52 Antibody [Allophycocyanin]
NBP1-71810APC 0.1 mL

Rabbit Polyclonal DDX52 Antibody [Allophycocyanin]

Sign In for Pricing
View Details
Mouse PSMC6 shRNA Plasmid
abx975963-01 150 µg

Mouse PSMC6 shRNA Plasmid

Sign In for Pricing
View Details
Mouse PSMC6 shRNA Plasmid
abx975963-02 300 µg

Mouse PSMC6 shRNA Plasmid

Sign In for Pricing
View Details