Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNIP2 Peptide - N-terminal region

KCNIP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KCHIP2

UniProt

Q9NS61

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNIP2 Rabbit Polyclonal Antibody (orb324609) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PRLLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNEC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ro 41-1049 hydrochloride
orb1706706-01 2 mg

Ro 41-1049 hydrochloride

Sign In for Pricing
View Details
Ro 41-1049 hydrochloride
orb1706706-02 5 mg

Ro 41-1049 hydrochloride

Sign In for Pricing
View Details
Ro 41-1049 hydrochloride
orb1706706-03 1 ml x 10 mM (in DMSO)

Ro 41-1049 hydrochloride

Sign In for Pricing
View Details
Anti-HER2 (Phospho-Y1248) Antibody
CPA4900-01 30 µL

Anti-HER2 (Phospho-Y1248) Antibody

Sign In for Pricing
View Details
Anti-HER2 (Phospho-Y1248) Antibody
CPA4900-02 50 μL

Anti-HER2 (Phospho-Y1248) Antibody

Sign In for Pricing
View Details
Anti-HER2 (Phospho-Y1248) Antibody
CPA4900-03 100 µL

Anti-HER2 (Phospho-Y1248) Antibody

Sign In for Pricing
View Details