Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNIP2 Peptide - N-terminal region

KCNIP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KCHIP2

UniProt

Q9NS61

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNIP2 Rabbit Polyclonal Antibody (orb324609) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PRLLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNEC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uroguanylin Isomer A (Human)
4295-s 0.1 mg

Uroguanylin Isomer A (Human)

Sign In for Pricing
View Details
Apoa4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
12159114 3x 1.0 µg

Apoa4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
CENP-S Lentiviral Activation Particles (m)
sc-427578-LAC 200 µL

CENP-S Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
MAN2B2 Protein Vector (Human) (pPM-C-His)
PV093053 500 ng

MAN2B2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
CNOT6 Human shRNA Lentiviral Particle (Locus ID 57472)
TL305321V 500 µL Each

CNOT6 Human shRNA Lentiviral Particle (Locus ID 57472)

Sign In for Pricing
View Details
Rat Hexokinase 2 (HK2) ELISA Kit
MBS2802186-01 48 Tests

Rat Hexokinase 2 (HK2) ELISA Kit

Sign In for Pricing
View Details