Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT9 Peptide - C-terminal region

NUDT9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NUDT9, NUDT10, PSEC0099, UNQ3012/PRO9771

UniProt

Q9BW91

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUDT9 Rabbit Polyclonal Antibody (orb575537) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGMVDPGEKISATLKREFGEEALNSLQKTSAEKREIEEKLHKLFSQDHLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRIG2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
27596061 1.0 µg DNA

LRIG2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
EGFR Polyclonal Antibody
RD70501A-01 60 μL

EGFR Polyclonal Antibody

Sign In for Pricing
View Details
EGFR Polyclonal Antibody
RD70501A-02 120 μL

EGFR Polyclonal Antibody

Sign In for Pricing
View Details
EGFR Polyclonal Antibody
RD70501A-03 200 µL

EGFR Polyclonal Antibody

Sign In for Pricing
View Details
SMCR8 Protein Vector (Mouse) (pPM-C-His)
PV231901 500 ng

SMCR8 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Lentiviral mouse Caprin1 shRNA (UAS) - Lentiviral mouse Caprin1 shRNA (UAS) (25)
GTR15214553 1 Vial

Lentiviral mouse Caprin1 shRNA (UAS) - Lentiviral mouse Caprin1 shRNA (UAS) (25)

Sign In for Pricing
View Details