Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT9 Peptide - C-terminal region

NUDT9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NUDT9, NUDT10, PSEC0099, UNQ3012/PRO9771

UniProt

Q9BW91

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUDT9 Rabbit Polyclonal Antibody (orb575537) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGMVDPGEKISATLKREFGEEALNSLQKTSAEKREIEEKLHKLFSQDHLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Neuroglobin Protein - (Dry Ice)
H00058157-P01-25ug 25 µg

Recombinant Human Neuroglobin Protein - (Dry Ice)

Sign In for Pricing
View Details
TKT 293 Cell Lysate
400450 0.1 mg

TKT 293 Cell Lysate

Sign In for Pricing
View Details
ALDH3B2 Antibody
E93726 100 µg

ALDH3B2 Antibody

Sign In for Pricing
View Details
Canine CUB Domain Containing Protein 1 ELISA Kit
MBS107467-01 48 Well

Canine CUB Domain Containing Protein 1 ELISA Kit

Sign In for Pricing
View Details
Canine CUB Domain Containing Protein 1 ELISA Kit
MBS107467-02 96 Well

Canine CUB Domain Containing Protein 1 ELISA Kit

Sign In for Pricing
View Details
Canine CUB Domain Containing Protein 1 ELISA Kit
MBS107467-03 5x 96 Well

Canine CUB Domain Containing Protein 1 ELISA Kit

Sign In for Pricing
View Details