Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF74 Peptide - N-terminal region

ZNF74 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZNF74, ZNF520

UniProt

Q16587

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF74 Rabbit Polyclonal Antibody (orb575573) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003417

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EFPLRCPLFAQQRVPEGGPLLDTRKNVQATEGRTKAPARLCAGENASTPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Retinol Binding Protein 4, Plasma (RBP4) ELISA Kit-Sandwich
EK3F294-01 48 Test

Rabbit Retinol Binding Protein 4, Plasma (RBP4) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Rabbit Retinol Binding Protein 4, Plasma (RBP4) ELISA Kit-Sandwich
EK3F294-02 96 Tests

Rabbit Retinol Binding Protein 4, Plasma (RBP4) ELISA Kit-Sandwich

Sign In for Pricing
View Details
ATRIP (Phospho-Ser224) Antibody
orb251742-01 50 μL

ATRIP (Phospho-Ser224) Antibody

Sign In for Pricing
View Details
ATRIP (Phospho-Ser224) Antibody
orb251742-02 100 µL

ATRIP (Phospho-Ser224) Antibody

Sign In for Pricing
View Details
Commelina Communis Extract
E3795-5mg 5 mg

Commelina Communis Extract

Sign In for Pricing
View Details
Kanadaptin (SLC4A1AP) Human Over-expression Lysate
orb1349420 100 µg

Kanadaptin (SLC4A1AP) Human Over-expression Lysate

Sign In for Pricing
View Details