Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF177 Peptide - middle region

ZNF177 Peptide - middle region

Product Specifications

UniProt

Q13360

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF177 Rabbit Polyclonal Antibody (orb324617) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003442

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASVGYQLCRHSLISKVDQEQLKTDERGILQGDCADWETQLKPKDTIAMQN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human GRIK2 (GluR6) Polyclonal Antibody
PA88244HU-01 50 µg

Rabbit Anti-Human GRIK2 (GluR6) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human GRIK2 (GluR6) Polyclonal Antibody
PA88244HU-02 100 µg

Rabbit Anti-Human GRIK2 (GluR6) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human GRIK2 (GluR6) Polyclonal Antibody
PA88244HU-03 500 µg

Rabbit Anti-Human GRIK2 (GluR6) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human GRIK2 (GluR6) Polyclonal Antibody
PA88244HU-04 1 mg

Rabbit Anti-Human GRIK2 (GluR6) Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human TMEM47, GST-tagged
TMEM47-3290H 25 µg

Recombinant Human TMEM47, GST-tagged

Sign In for Pricing
View Details
Recombinant Human HPGDS Protein, His, E.coli-20ug
QP12302-20ug 20ug

Recombinant Human HPGDS Protein, His, E.coli-20ug

Sign In for Pricing
View Details