Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF177 Peptide - middle region

ZNF177 Peptide - middle region

Product Specifications

UniProt

Q13360

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF177 Rabbit Polyclonal Antibody (orb324617) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003442

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASVGYQLCRHSLISKVDQEQLKTDERGILQGDCADWETQLKPKDTIAMQN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GON4L (NM_032292) Human Tagged Lenti ORF Clone
RC216608L3 10 µg

GON4L (NM_032292) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Gamma Adaptin Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-62398R-BF647 100 µL

Gamma Adaptin Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
MIR1915 Human MicroRNA Expression Plasmid (MI0008336)
SC400230 10 µg

MIR1915 Human MicroRNA Expression Plasmid (MI0008336)

Sign In for Pricing
View Details
Mmu-miR-6955-5p miRNA Agomir
orb1917593-01 5 nmol

Mmu-miR-6955-5p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-6955-5p miRNA Agomir
orb1917593-02 10 nmol

Mmu-miR-6955-5p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-6955-5p miRNA Agomir
orb1917593-03 20 nmol

Mmu-miR-6955-5p miRNA Agomir

Sign In for Pricing
View Details