Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FEV Peptide - C-terminal region

FEV Peptide - C-terminal region

Product Specifications

Product Name Alternative

FEV, PET1

UniProt

Q99581

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FEV Rabbit Polyclonal Antibody (orb575708) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_059991

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: APAGFSYWPGPGPAATAAAATAALYPSPSLQPPPGPFGAVAAASHLGGHY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCF21 Rabbit Monoclonal Antibody
E49Y8173 100 µL

TCF21 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Mouse TNFRSF12A (Tumor necrosis factor receptor superfamily member 12A) ELISA Kit
EM2139 96 Tests

Mouse TNFRSF12A (Tumor necrosis factor receptor superfamily member 12A) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human NRBP1 sgRNA gene knockout kit - Lentiviral human NRBP1 sgRNA gene knockout kit (100)
GTR15369469 1 Vial

Lentiviral human NRBP1 sgRNA gene knockout kit - Lentiviral human NRBP1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Rabbit Polyclonal KPNA5 Antibody
TA590118 100 µg

Rabbit Polyclonal KPNA5 Antibody

Sign In for Pricing
View Details
Kinesis Hollow Cathode Lamp Phosphorous 50mm PE AAnalyst (Lumina)
CHR5863 1 Each

Kinesis Hollow Cathode Lamp Phosphorous 50mm PE AAnalyst (Lumina)

Sign In for Pricing
View Details
Mgat4a (NM_001290801) Mouse Tagged ORF Clone
MR230386 10 µg

Mgat4a (NM_001290801) Mouse Tagged ORF Clone

Sign In for Pricing
View Details