Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FEV Peptide - C-terminal region

FEV Peptide - C-terminal region

Product Specifications

Product Name Alternative

FEV, PET1

UniProt

Q99581

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FEV Rabbit Polyclonal Antibody (orb575708) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_059991

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: APAGFSYWPGPGPAATAAAATAALYPSPSLQPPPGPFGAVAAASHLGGHY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nudcd2 Rat shRNA Plasmid (Locus ID 287199)
TL701274 1 Kit

Nudcd2 Rat shRNA Plasmid (Locus ID 287199)

Sign In for Pricing
View Details
MRS1706 100mg
A16868-100 100 mg

MRS1706 100mg

Sign In for Pricing
View Details
GTF2I sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0917207 1.0 µg DNA

GTF2I sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Recombinant Human SAA1 protein, His-tagged
SAA1-3463H 25 µg

Recombinant Human SAA1 protein, His-tagged

Sign In for Pricing
View Details
Exo-Flow96 CD81 IP kit
EXOFLOW96A-CD81 96 Reactions

Exo-Flow96 CD81 IP kit

Sign In for Pricing
View Details
SEP10 Rabbit Polyclonal Antibody
E28PN1250 100 µL

SEP10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details