Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF160 Peptide - C-terminal region

ZNF160 Peptide - C-terminal region

Product Specifications

Product Name Alternative

F11, HZF5, KR18, HKr18

UniProt

Q9HCG1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF160 Rabbit Polyclonal Antibody (orb575800) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_006723525

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KVFTQNSHLANHQRTHTGEKPYRCNECGKAFSVRSSLTTHQAIHTGKKPY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Basal cell cytokeratin Antibody (RCK103) [CoraFluor 1]
NBP1-97729CL1 0.1 mL

Mouse Monoclonal Basal cell cytokeratin Antibody (RCK103) [CoraFluor 1]

Sign In for Pricing
View Details
Peroxiredoxin 1 Rabbit Polyclonal Antibody (AP)
orb898284 100 µL

Peroxiredoxin 1 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Phospho-KLF5 (Ser272) Rabbit Polyclonal Antibody
orb10957-01 50 μL

Phospho-KLF5 (Ser272) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-KLF5 (Ser272) Rabbit Polyclonal Antibody
orb10957-02 100 µL

Phospho-KLF5 (Ser272) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-KLF5 (Ser272) Rabbit Polyclonal Antibody
orb10957-03 200 µL

Phospho-KLF5 (Ser272) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BMP8A Antibody
orb685156 100 µL

BMP8A Antibody

Sign In for Pricing
View Details