ZNF160 Peptide - C-terminal region
ZNF160 Peptide - C-terminal region
Product Specifications
Product Name Alternative
F11, HZF5, KR18, HKr18
UniProt
Q9HCG1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF160 Rabbit Polyclonal Antibody (orb575800) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
XP_006723525
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KVFTQNSHLANHQRTHTGEKPYRCNECGKAFSVRSSLTTHQAIHTGKKPY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6286191-01 0.1 mL
CILP2, ID (CILP2, Cartilage intermediate layer protein 2, Cartilage intermediate layer protein 2 C1, Cartilage intermediate layer protein 2 C2) (MaxLight 550)
Sign In for Pricing
View Details MBS6286191-02 5x 0.1 mL
CILP2, ID (CILP2, Cartilage intermediate layer protein 2, Cartilage intermediate layer protein 2 C1, Cartilage intermediate layer protein 2 C2) (MaxLight 550)
Sign In for Pricing
View Details