Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E2F7 Peptide - N-terminal region

E2F7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

E2f7

UniProt

Q6S7F2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with E2f7 Rabbit Polyclonal Antibody (orb329925) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_006513945

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MEVNCLTLKDLISPRQTRLDFAIEDAENAQKENIFVDRSRMTPKTPMKNE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDAP1 Peptide - N-terminal region
orb2012096 100 µg

PDAP1 Peptide - N-terminal region

Sign In for Pricing
View Details
(2-Thienylthio) acetonitrile
419197-01 1 g

(2-Thienylthio) acetonitrile

Sign In for Pricing
View Details
(2-Thienylthio) acetonitrile
419197-02 5 g

(2-Thienylthio) acetonitrile

Sign In for Pricing
View Details
LINC00338 Recombinant Protein (Human)
RP068559 100 µg

LINC00338 Recombinant Protein (Human)

Sign In for Pricing
View Details
Dog/Canine 12-Lipoxygenase LOX-12 ELISA Kit
BG-CAN11499 1 Each

Dog/Canine 12-Lipoxygenase LOX-12 ELISA Kit

Sign In for Pricing
View Details
C1 Esterase Inhibitor Antibody
A1113-30T 30 µg

C1 Esterase Inhibitor Antibody

Sign In for Pricing
View Details